Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:28450] [233823] (1 PDB entry) |
Domain d3uzua_: 3uzu A: [233824] automated match to d3tpzb_ complexed with edo |
PDB Entry: 3uzu (more details), 1.75 Å
SCOPe Domain Sequences for d3uzua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uzua_ c.66.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]} krfgqnflvdhgvidaivaairpergermveigpglgaltgpviarlatpgsplhaveld rdligrleqrfgellelhagdaltfdfgsiarpgdepslriignlpynisspllfhlmsf apvvidqhfmlqnevvermvaepgtkafsrlsvmlqyryvmdklidvppesfqpppkvds aivrmiphaphelpavdpavlgevvtaafsqrrkmlrntlggyrdlvdfdalgfdlarra edigvdeyvrvaqavasarasg
Timeline for d3uzua_: