Lineage for d3uzua_ (3uzu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894524Species Burkholderia pseudomallei [TaxId:28450] [233823] (1 PDB entry)
  8. 2894525Domain d3uzua_: 3uzu A: [233824]
    automated match to d3tpzb_
    complexed with edo

Details for d3uzua_

PDB Entry: 3uzu (more details), 1.75 Å

PDB Description: the structure of the ribosomal rna small subunit methyltransferase a from burkholderia pseudomallei
PDB Compounds: (A:) Ribosomal RNA small subunit methyltransferase A

SCOPe Domain Sequences for d3uzua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uzua_ c.66.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
krfgqnflvdhgvidaivaairpergermveigpglgaltgpviarlatpgsplhaveld
rdligrleqrfgellelhagdaltfdfgsiarpgdepslriignlpynisspllfhlmsf
apvvidqhfmlqnevvermvaepgtkafsrlsvmlqyryvmdklidvppesfqpppkvds
aivrmiphaphelpavdpavlgevvtaafsqrrkmlrntlggyrdlvdfdalgfdlarra
edigvdeyvrvaqavasarasg

SCOPe Domain Coordinates for d3uzua_:

Click to download the PDB-style file with coordinates for d3uzua_.
(The format of our PDB-style files is described here.)

Timeline for d3uzua_: