Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Guinea fowl (Numida meleagris) [TaxId:8996] [53964] (2 PDB entries) |
Domain d1hhl__: 1hhl - [36398] |
PDB Entry: 1hhl (more details), 1.9 Å
SCOP Domain Sequences for d1hhl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hhl__ d.2.1.2 (-) Lysozyme {Guinea fowl (Numida meleagris)} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgdgmnawvawrkhckgtdv rvwikgcrl
Timeline for d1hhl__: