Lineage for d1hhl__ (1hhl -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28955Species Guinea fowl (Numida meleagris) [TaxId:8996] [53964] (2 PDB entries)
  8. 28956Domain d1hhl__: 1hhl - [36398]

Details for d1hhl__

PDB Entry: 1hhl (more details), 1.9 Å

PDB Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes

SCOP Domain Sequences for d1hhl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhl__ d.2.1.2 (-) Lysozyme {Guinea fowl (Numida meleagris)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgdgmnawvawrkhckgtdv
rvwikgcrl

SCOP Domain Coordinates for d1hhl__:

Click to download the PDB-style file with coordinates for d1hhl__.
(The format of our PDB-style files is described here.)

Timeline for d1hhl__: