![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
![]() | Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Guinea fowl (Numida meleagris) [TaxId:8996] [53964] (2 PDB entries) |
![]() | Domain d1hhla_: 1hhl A: [36398] |
PDB Entry: 1hhl (more details), 1.9 Å
SCOPe Domain Sequences for d1hhla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hhla_ d.2.1.2 (A:) Lysozyme {Guinea fowl (Numida meleagris) [TaxId: 8996]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgdgmnawvawrkhckgtdv rvwikgcrl
Timeline for d1hhla_: