Lineage for d6hwbr_ (6hwb R:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600522Domain d6hwbr_: 6hwb R: [363947]
    Other proteins in same PDB: d6hwbe_, d6hwbg_, d6hwbi_, d6hwbj_, d6hwbk_, d6hwbl_, d6hwbn_, d6hwbo_, d6hwbs_, d6hwbu_, d6hwbw_, d6hwbx_, d6hwby_, d6hwbz_
    automated match to d1rype_
    complexed with cl, gwt, mes, mg

Details for d6hwbr_

PDB Entry: 6hwb (more details), 2.6 Å

PDB Description: yeast 20s proteasome in complex with 44b
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d6hwbr_:

Sequence, based on SEQRES records: (download)

>d6hwbr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d6hwbr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d6hwbr_:

Click to download the PDB-style file with coordinates for d6hwbr_.
(The format of our PDB-style files is described here.)

Timeline for d6hwbr_: