Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6hvwq_: 6hvw Q: [363926] Other proteins in same PDB: d6hvwa_, d6hvwe_, d6hvwg_, d6hvwi_, d6hvwj_, d6hvwk_, d6hvwl_, d6hvwn_, d6hvwo_, d6hvws_, d6hvwu_, d6hvww_, d6hvwx_, d6hvwy_, d6hvwz_ automated match to d1rypd_ complexed with cl, gvw, mes, mg |
PDB Entry: 6hvw (more details), 3 Å
SCOPe Domain Sequences for d6hvwq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvwq_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d6hvwq_: