Lineage for d6hvwq_ (6hvw Q:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2601199Domain d6hvwq_: 6hvw Q: [363926]
    Other proteins in same PDB: d6hvwa_, d6hvwe_, d6hvwg_, d6hvwi_, d6hvwj_, d6hvwk_, d6hvwl_, d6hvwn_, d6hvwo_, d6hvws_, d6hvwu_, d6hvww_, d6hvwx_, d6hvwy_, d6hvwz_
    automated match to d1rypd_
    complexed with cl, gvw, mes, mg

Details for d6hvwq_

PDB Entry: 6hvw (more details), 3 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with 43
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6hvwq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hvwq_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d6hvwq_:

Click to download the PDB-style file with coordinates for d6hvwq_.
(The format of our PDB-style files is described here.)

Timeline for d6hvwq_:

  • d6hvwq_ is new in SCOPe 2.07-stable
  • d6hvwq_ appears in the current release, SCOPe 2.08, called d6hvwq1