Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hvwc1: 6hvw C:1-234 [363795] Other proteins in same PDB: d6hvwa_, d6hvwc2, d6hvwe_, d6hvwg_, d6hvwi_, d6hvwj_, d6hvwk_, d6hvwl_, d6hvwn_, d6hvwo_, d6hvwq2, d6hvws_, d6hvwu_, d6hvww_, d6hvwx_, d6hvwy_, d6hvwz_ automated match to d1rypd_ complexed with cl, gvw, mes, mg |
PDB Entry: 6hvw (more details), 3 Å
SCOPe Domain Sequences for d6hvwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvwc1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d6hvwc1:
View in 3D Domains from other chains: (mouse over for more information) d6hvwa_, d6hvwb_, d6hvwd_, d6hvwe_, d6hvwf_, d6hvwg_, d6hvwh_, d6hvwi_, d6hvwj_, d6hvwk_, d6hvwl_, d6hvwm_, d6hvwn_, d6hvwo_, d6hvwp_, d6hvwq1, d6hvwq2, d6hvwr_, d6hvws_, d6hvwt_, d6hvwu_, d6hvwv_, d6hvww_, d6hvwx_, d6hvwy_, d6hvwz_ |