SCOPe 2.08: Domain d6hvwc1: 6hvw C:1-234

Lineage for d6hvwc1 (6hvw C:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d6hvwc1: 6hvw C:1-234 [363795]
   Other proteins in same PDB: d6hvwa_, d6hvwc2, d6hvwe_, d6hvwg_, d6hvwi_, d6hvwj_, d6hvwk_, d6hvwl_, d6hvwn_, d6hvwo_, d6hvwq2, d6hvws_, d6hvwu_, d6hvww_, d6hvwx_, d6hvwy_, d6hvwz_
   automated match to d1rypd_
   complexed with cl, gvw, mes, mg

Details for d6hvwc1

PDB Entry: 6hvw, 3 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with 43

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6hvwc1:

Sequence; same for both SEQRES and ATOM records:

>d6hvwc1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d6hvwc1:

• d6hvwc1 first appeared in SCOPe 2.07, called d6hvwc_