Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6hvab_: 6hva B: [363662] Other proteins in same PDB: d6hvae_, d6hvag_, d6hvai_, d6hvaj_, d6hvak_, d6hval_, d6hvan_, d6hvao_, d6hvas_, d6hvau_, d6hvaw_, d6hvax_, d6hvay_, d6hvaz_ automated match to d4cr2c_ complexed with cl, gqt, mg |
PDB Entry: 6hva (more details), 2.9 Å
SCOPe Domain Sequences for d6hvab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvab_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d6hvab_: