Lineage for d6huvm_ (6huv M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2995048Domain d6huvm_: 6huv M: [363559]
    Other proteins in same PDB: d6huvc2, d6huve_, d6huvg_, d6huvi_, d6huvj_, d6huvk_, d6huvl_, d6huvn_, d6huvo_, d6huvq2, d6huvs_, d6huvu_, d6huvw_, d6huvx_, d6huvy_, d6huvz_
    automated match to d4j70m_
    complexed with cl, gt8, mes, mg, so4

Details for d6huvm_

PDB Entry: 6huv (more details), 3.1 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 39
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6huvm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6huvm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakd

SCOPe Domain Coordinates for d6huvm_:

Click to download the PDB-style file with coordinates for d6huvm_.
(The format of our PDB-style files is described here.)

Timeline for d6huvm_: