SCOPe 2.07: Domain d6c5na1: 6c5n A:2-182

Lineage for d6c5na1 (6c5n A:2-182)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:273036] [340195] (4 PDB entries)

8. Domain d6c5na1: 6c5n A:2-182 [363109]
   Other proteins in same PDB: d6c5na2, d6c5nb2
   automated match to d4kqxb1
   complexed with 81b, en4, imd, mg, ndp

Details for d6c5na1

PDB Entry: 6c5n, 1.67 Å

PDB Description: crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 1

PDB Compounds: (A:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6c5na1:

Sequence; same for both SEQRES and ATOM records:

>d6c5na1 c.2.1.0 (A:2-182) automated matches {Staphylococcus aureus [TaxId: 273036]}
ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
t

Timeline for d6c5na1:

• d6c5na1 is new in SCOPe 2.07-stable
  
• d6c5na1 appears in the current release, SCOPe 2.08