Lineage for d6c5na1 (6c5n A:2-182)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (309 species)
    not a true protein
  7. 2432371Species Staphylococcus aureus [TaxId:273036] [340195] (4 PDB entries)
  8. 3063047Domain d6c5na1: 6c5n A:2-182 [363109]
    Other proteins in same PDB: d6c5na2, d6c5nb2
    automated match to d4kqxb1
    complexed with 81b, en4, imd, mg, ndp

Details for d6c5na1

PDB Entry: 6c5n (more details), 1.67 Å

PDB Description: crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 1
PDB Compounds: (A:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6c5na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c5na1 c.2.1.0 (A:2-182) automated matches {Staphylococcus aureus [TaxId: 273036]}
ttvyydqdvktdalqgkkiavvgygsqghahaqnlkdngydvvigirpgrsfdkakedgf
dvfpvaeavkqadvimvllpdeiqgdvykneiepnlekhnalafahgfnihfgviqppad
vdvflvapkgpghlvrrtfvegsavpslfgiqqdasgqarnialsyakgigatragviet
t

SCOPe Domain Coordinates for d6c5na1:

Click to download the PDB-style file with coordinates for d6c5na1.
(The format of our PDB-style files is described here.)

Timeline for d6c5na1:

  • d6c5na1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6c5na2