|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest | 
|  | Superfamily c.62.1: vWA-like [53300] (6 families)  | 
|  | Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) | 
|  | Protein automated matches [190060] (2 species) not a true protein | 
|  | Species Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries) | 
|  | Domain d6nd9l_: 6nd9 L: [362946] Other proteins in same PDB: d6nd9a_, d6nd9b_, d6nd9d_, d6nd9e_, d6nd9g_, d6nd9h_, d6nd9j_, d6nd9k_, d6nd9m_, d6nd9n_, d6nd9p_, d6nd9q_ automated match to d1aoxb_ complexed with ca, cl, gol, na, nh4, so4 | 
PDB Entry: 6nd9 (more details), 2.9 Å
SCOPe Domain Sequences for d6nd9l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nd9l_ c.62.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
ekagtlgeqif
Timeline for d6nd9l_: