Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (10 species) not a true protein |
Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (10 PDB entries) |
Domain d6nd9g_: 6nd9 G: [362894] Other proteins in same PDB: d6nd9c_, d6nd9f_, d6nd9i_, d6nd9l_, d6nd9o_, d6nd9r_ automated match to d1v4la_ complexed with ca, cl, gol, na, nh4, so4 |
PDB Entry: 6nd9 (more details), 2.9 Å
SCOPe Domain Sequences for d6nd9g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nd9g_ d.169.1.1 (G:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq aknpfvckfps
Timeline for d6nd9g_: