Lineage for d5yk3h_ (5yk3 H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577625Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2577626Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2577657Protein automated matches [190414] (3 species)
    not a true protein
  7. 2577667Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries)
  8. 2577691Domain d5yk3h_: 5yk3 H: [362940]
    Other proteins in same PDB: d5yk3b2, d5yk3c2
    automated match to d6ehpa_

Details for d5yk3h_

PDB Entry: 5yk3 (more details), 3.01 Å

PDB Description: human ragulator complex
PDB Compounds: (H:) Ragulator complex protein LAMTOR3

SCOPe Domain Sequences for d5yk3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yk3h_ d.110.7.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqg
sklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqv
vevs

SCOPe Domain Coordinates for d5yk3h_:

Click to download the PDB-style file with coordinates for d5yk3h_.
(The format of our PDB-style files is described here.)

Timeline for d5yk3h_: