Lineage for d6ehpa_ (6ehp A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) 
alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helicesFamily d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
Pfam PF03259
Protein automated matches [190414] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries) 
Domain d6ehpa_: 6ehp A: [339755]
automated match to d1veta_
complexed with cl
Details for d6ehpa_
PDB Entry: 6ehp (more details), 2.3 Å
PDB Description: the crystal structure of the human lamtor complex
PDB Compounds: (A:) Ragulator complex protein LAMTOR3SCOPe Domain Sequences for d6ehpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ehpa_ d.110.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqg
sklglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqv
ve
SCOPe Domain Coordinates for d6ehpa_:
Click to download the PDB-style file with coordinates for d6ehpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6ehpa_:
View in 3D
