Lineage for d6ndfi_ (6ndf I:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500013Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2500014Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2500015Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2500166Protein automated matches [190060] (2 species)
    not a true protein
  7. 2500169Species Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries)
  8. 2500234Domain d6ndfi_: 6ndf I: [362921]
    Other proteins in same PDB: d6ndfa_, d6ndfb_, d6ndfd_, d6ndfe_, d6ndfg_, d6ndfh_, d6ndfj_, d6ndfk_, d6ndfm_, d6ndfn_, d6ndfp_, d6ndfq_
    automated match to d1aoxb_
    complexed with cl, na, nh4, so4, sr

Details for d6ndfi_

PDB Entry: 6ndf (more details), 3.05 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain with strontium
PDB Compounds: (I:) Integrin alpha-2

SCOPe Domain Sequences for d6ndfi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ndfi_ c.62.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
ekagtlgeqif

SCOPe Domain Coordinates for d6ndfi_:

Click to download the PDB-style file with coordinates for d6ndfi_.
(The format of our PDB-style files is described here.)

Timeline for d6ndfi_: