|  | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) | 
|  | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold | 
|  | Superfamily d.169.1: C-type lectin-like [56436] (9 families)  | 
|  | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 | 
|  | Protein automated matches [190329] (10 species) not a true protein | 
|  | Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (10 PDB entries) | 
|  | Domain d6ndfp_: 6ndf P: [362884] Other proteins in same PDB: d6ndfc_, d6ndff_, d6ndfi_, d6ndfl_, d6ndfo_, d6ndfr_ automated match to d1v4la_ complexed with cl, na, nh4, so4, sr | 
PDB Entry: 6ndf (more details), 3.05 Å
SCOPe Domain Sequences for d6ndfp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ndfp_ d.169.1.1 (P:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
aknpfvckfps
Timeline for d6ndfp_: