Lineage for d6mgje1 (6mgj E:35-441)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2419123Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) (S)
    duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)
  5. 2419137Family b.69.13.0: automated matches [227242] (1 protein)
    not a true family
  6. 2419138Protein automated matches [227008] (11 species)
    not a true protein
  7. 2419179Species Paenibacillus odorifer [TaxId:189426] [362770] (3 PDB entries)
  8. 2419190Domain d6mgje1: 6mgj E:35-441 [362780]
    Other proteins in same PDB: d6mgja3, d6mgjb3, d6mgjc3, d6mgjd3, d6mgje3, d6mgjf3, d6mgjg3, d6mgjh3
    automated match to d4lgna1
    complexed with cl, gol, mg, pe3, po4

Details for d6mgje1

PDB Entry: 6mgj (more details), 2 Å

PDB Description: crystal structure of the catalytic domain from gh74 enzyme pogh74 from paenibacillus odorifer, apoenzyme
PDB Compounds: (E:) xyloglucanase

SCOPe Domain Sequences for d6mgje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mgje1 b.69.13.0 (E:35-441) automated matches {Paenibacillus odorifer [TaxId: 189426]}
sepytwksvvtgagggfvpgiifnqtepnliyartdiggayrwnqatsswvsisdsvgwv
dwnkngvdalatdpidpnkvymatgtytnhwdnngqimrsndrgntwqttplpfkvggnm
pgrsagerlvidpnknnilyfgarsgnglwksidsgvtwskvtsfpnvgtyiqnptldyg
ndlvglswitfdkstgtlgnatqtiyvgvadtassvyrstdggvtwtalagqptgflphh
gelsstgdlyitysngvgpydgskgevwkynktsgawtnispttgtdnwygfgglaldaq
hpntlmvsslnawwpdevifrstnggatwsriwdwgnypertykfsmditaapwldhgtt
stsldpspklgwmmgdleidpfnsnrmmygtgatiygsnnltswdtg

SCOPe Domain Coordinates for d6mgje1:

Click to download the PDB-style file with coordinates for d6mgje1.
(The format of our PDB-style files is described here.)

Timeline for d6mgje1: