Class b: All beta proteins [48724] (178 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378) |
Family b.69.13.0: automated matches [227242] (1 protein) not a true family |
Protein automated matches [227008] (11 species) not a true protein |
Species Paenibacillus odorifer [TaxId:189426] [362770] (3 PDB entries) |
Domain d6mgjf2: 6mgj F:442-779 [362772] Other proteins in same PDB: d6mgja3, d6mgjb3, d6mgjc3, d6mgjd3, d6mgje3, d6mgjf3, d6mgjg3, d6mgjh3 automated match to d4lgna2 complexed with cl, gol, mg, pe3, po4 |
PDB Entry: 6mgj (more details), 2 Å
SCOPe Domain Sequences for d6mgjf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mgjf2 b.69.13.0 (F:442-779) automated matches {Paenibacillus odorifer [TaxId: 189426]} gkvnisvmakgveetavlglispptgtshlitalgdvsgfrhedlsvaptkfqtspswat tmsidyaelspsymvrvgsadkektpsmksigisndggvnwympnsepsngtkttvghgq vavsasgnsilwstsdigvyysktsgnswtasaglpagakiasdrvnpnkyygfyagtfy vsvdggatftatgasgfptnnvaglqpneaqismkavpgiegdiwfaggntvenkyglwh stnsgasftkltnveeadligygkaapgqtymslytvakidgvrgvfrsddvgatwvrin ddahqyakinmaitgdpriygrvylgtngrgtlyadpv
Timeline for d6mgjf2: