Lineage for d6h1fa1 (6h1f A:2-127)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (170 PDB entries)
  8. 3062653Domain d6h1fa1: 6h1f A:2-127 [362715]
    Other proteins in same PDB: d6h1fa2, d6h1fb_
    automated match to d4ocmc_
    complexed with scn

Details for d6h1fa1

PDB Entry: 6h1f (more details), 1.9 Å

PDB Description: structure of the nanobody-stabilized gelsolin d187n variant (second domain)
PDB Compounds: (A:) gelsolin nanobody, Nb11

SCOPe Domain Sequences for d6h1fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h1fa1 b.1.1.1 (A:2-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtrya
dsakgrftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqgt
qvtvss

SCOPe Domain Coordinates for d6h1fa1:

Click to download the PDB-style file with coordinates for d6h1fa1.
(The format of our PDB-style files is described here.)

Timeline for d6h1fa1:

  • d6h1fa1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-24

View in 3D
Domains from same chain:
(mouse over for more information)
d6h1fa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6h1fb_