PDB entry 6h1f

View 6h1f on RCSB PDB site
Description: Structure of the nanobody-stabilized gelsolin D187N variant (second domain)
Class: structural protein
Keywords: Amyloidosis, calcium, misfolding, nanobody, mutation, STRUCTURAL PROTEIN
Deposited on 2018-07-11, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelsolin nanobody, Nb11
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H1F
    Domains in SCOPe 2.07: d6h1fa1, d6h1fa2
  • Chain 'B':
    Compound: gelsolin
    Species: Homo sapiens [TaxId:9606]
    Gene: GSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06396
      • engineered mutation (39)
    Domains in SCOPe 2.07: d6h1fb_
  • Heterogens: SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h1fA (A:)
    mqvqlqesggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtr
    yadsakgrftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgq
    gtqvtvsslvprgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h1fA (A:)
    vqlqesggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtrya
    dsakgrftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqgt
    qvtvssl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h1fB (B:)
    gshhvvpnevvvqrlfqvkgrrvvratevpvswesfnngncfildlgnnihqwcgsnsnr
    yerlkatqvskgirdnersgrarvhvseegtepeamlqvlgpkpalpagtedtakedaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h1fB (B:)
    vvvqrlfqvkgrrvvratevpvswesfnngncfildlgnnihqwcgsnsnryerlkatqv
    skgirdnersgrarvhvseegtepeamlqvlgpkpalpagte