SCOPe 2.08: Domain d6mj6a1: 6mj6 A:6-185

Lineage for d6mj6a1 (6mj6 A:6-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6mj6a1: 6mj6 A:6-185 [362370]
   Other proteins in same PDB: d6mj6a2, d6mj6b_, d6mj6c1, d6mj6c2, d6mj6d1, d6mj6d2
   automated match to d1zt4c2
   complexed with gol, jtm, na, nag

Details for d6mj6a1

PDB Entry: 6mj6, 2.45 Å

PDB Description: crystal structure of the mcd1d/xxx (jj166) /inktcr ternary complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6mj6a1:

Sequence; same for both SEQRES and ATOM records:

>d6mj6a1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d6mj6a1:

• d6mj6a1 first appeared in SCOPe 2.07