Lineage for d6mj6d2 (6mj6 D:113-240)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756170Domain d6mj6d2: 6mj6 D:113-240 [362593]
    Other proteins in same PDB: d6mj6a1, d6mj6b_, d6mj6c2
    automated match to d3q5ya2
    complexed with gol, jtm, na, nag

Details for d6mj6d2

PDB Entry: 6mj6 (more details), 2.45 Å

PDB Description: crystal structure of the mcd1d/xxx (jj166) /inktcr ternary complex
PDB Compounds: (D:) Beta-chain,T cell receptor chain,T cell receptor beta constant 2, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mj6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mj6d2 b.1.1.0 (D:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d6mj6d2:

Click to download the PDB-style file with coordinates for d6mj6d2.
(The format of our PDB-style files is described here.)

Timeline for d6mj6d2: