Lineage for d6mr6a_ (6mr6 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503335Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2503563Protein NifS-like protein/selenocysteine lyase [53412] (5 species)
  7. 2503575Species Escherichia coli [TaxId:83333] [362244] (10 PDB entries)
  8. 2503580Domain d6mr6a_: 6mr6 A: [362299]
    automated match to d1jf9a_
    complexed with plp

Details for d6mr6a_

PDB Entry: 6mr6 (more details), 2.02 Å

PDB Description: e. coli cysteine desulfurase sufs h55a with a cysteine persulfide intermediate
PDB Compounds: (A:) Cysteine desulfurase

SCOPe Domain Sequences for d6mr6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mr6a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 83333]}
ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavargihtl
saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg

SCOPe Domain Coordinates for d6mr6a_:

Click to download the PDB-style file with coordinates for d6mr6a_.
(The format of our PDB-style files is described here.)

Timeline for d6mr6a_: