Lineage for d5z65a2 (5z65 A:283-544)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2965055Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries)
  8. 2965077Domain d5z65a2: 5z65 A:283-544 [361966]
    Other proteins in same PDB: d5z65a1, d5z65a3, d5z65a4
    automated match to d4fkea2
    complexed with nag, zn

Details for d5z65a2

PDB Entry: 5z65 (more details), 2.65 Å

PDB Description: crystal structure of porcine aminopeptidase n ectodomain in functional form
PDB Compounds: (A:) aminopeptidase

SCOPe Domain Sequences for d5z65a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z65a2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntpyplpksdqialp
dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl
wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq
isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda
qtsirlpdtvraimdrwtlqmg

SCOPe Domain Coordinates for d5z65a2:

Click to download the PDB-style file with coordinates for d5z65a2.
(The format of our PDB-style files is described here.)

Timeline for d5z65a2: