PDB entry 5z65

View 5z65 on RCSB PDB site
Description: Crystal structure of porcine aminopeptidase N ectodomain in functional form
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-01-22, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminopeptidase
    Species: Sus scrofa [TaxId:9823]
    Gene: ANPEP, pAPN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z65a1, d5z65a2, d5z65a3, d5z65a4
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z65A (A:)
    rsqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihs
    kklnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqge
    laddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnlta
    lsnmppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwar
    pnaiaeghgmyalnvtgpilnffanhyntpyplpksdqialpdfnagamenwglvtyren
    allfdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadha
    eptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvir
    mlsnfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwt
    lqmgfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrd
    vsqaqndlfktasddwvllninvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviy
    dsfnlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylr
    kqveplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdp
    ennpihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnr
    ylgytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliq
    gvtrrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfi
    ehstrtghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z65A (A:)
    skpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihskkl
    nyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgelad
    dlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsn
    mppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpna
    iaeghgmyalnvtgpilnffanhyntpyplpksdqialpdfnagamenwglvtyrenall
    fdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaept
    wnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirmls
    nfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlqm
    gfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsq
    aqndlfktasddwvllninvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviydsf
    nlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkqv
    eplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpenn
    pihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnrylg
    ytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgvt
    rrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfiehs