Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (18 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries) |
Domain d5z65a2: 5z65 A:283-544 [361966] Other proteins in same PDB: d5z65a1, d5z65a3, d5z65a4 automated match to d4fkea2 complexed with nag, zn |
PDB Entry: 5z65 (more details), 2.65 Å
SCOPe Domain Sequences for d5z65a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z65a2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]} qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntpyplpksdqialp dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda qtsirlpdtvraimdrwtlqmg
Timeline for d5z65a2: