Lineage for d5zc1c_ (5zc1 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2542784Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2542960Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2542961Protein automated matches [190558] (13 species)
    not a true protein
  7. 2542970Species Clonorchis sinensis [TaxId:79923] [361834] (1 PDB entry)
  8. 2542973Domain d5zc1c_: 5zc1 C: [361837]
    automated match to d2octa_

Details for d5zc1c_

PDB Entry: 5zc1 (more details), 2.3 Å

PDB Description: x-ray diffraction analysis of the csstefin-1
PDB Compounds: (C:) Cystatin-1

SCOPe Domain Sequences for d5zc1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zc1c_ d.17.1.0 (C:) automated matches {Clonorchis sinensis [TaxId: 79923]}
mpicggisaariptadekkklepvllqslyahlgskptsaevvlvatqvvagtnyfakvk
vnndhyihtrvyeqlpcyggalelhsvqmnktdtdpldyf

SCOPe Domain Coordinates for d5zc1c_:

Click to download the PDB-style file with coordinates for d5zc1c_.
(The format of our PDB-style files is described here.)

Timeline for d5zc1c_: