Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (13 species) not a true protein |
Species Clonorchis sinensis [TaxId:79923] [361834] (1 PDB entry) |
Domain d5zc1a_: 5zc1 A: [361848] automated match to d2octa_ |
PDB Entry: 5zc1 (more details), 2.3 Å
SCOPe Domain Sequences for d5zc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zc1a_ d.17.1.0 (A:) automated matches {Clonorchis sinensis [TaxId: 79923]} vmpicggisaariptadekkklepvllqslyahlgskptsaevvlvatqvvagtnyfakv kvnndhyihtrvyeqlpcyggalelhsvqmnktdtdpldyf
Timeline for d5zc1a_: