SCOPe 2.07: Domain d5zc1a_: 5zc1 A:

Lineage for d5zc1a_ (5zc1 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.0: automated matches [191407] (1 protein)
   not a true family

6. Protein automated matches [190558] (13 species)
   not a true protein

7. Species Clonorchis sinensis [TaxId:79923] [361834] (1 PDB entry)

8. Domain d5zc1a_: 5zc1 A: [361848]
   automated match to d2octa_

Details for d5zc1a_

PDB Entry: 5zc1, 2.3 Å

PDB Description: x-ray diffraction analysis of the csstefin-1

PDB Compounds: (A:) Cystatin-1

SCOPe Domain Sequences for d5zc1a_:

Sequence; same for both SEQRES and ATOM records:

>d5zc1a_ d.17.1.0 (A:) automated matches {Clonorchis sinensis [TaxId: 79923]}
vmpicggisaariptadekkklepvllqslyahlgskptsaevvlvatqvvagtnyfakv
kvnndhyihtrvyeqlpcyggalelhsvqmnktdtdpldyf

Timeline for d5zc1a_:

• d5zc1a_ is new in SCOPe 2.07-stable
  
• d5zc1a_ appears in the current release, SCOPe 2.08