SCOPe 2.06: Domain d1bnea_: 1bne A:

Lineage for d1bnea_ (1bne A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)

8. Domain d1bnea_: 1bne A: [36181]
   mutant

Details for d1bnea_

PDB Entry: 1bne, 2.1 Å

PDB Description: barnase a43c/s80c disulfide mutant

PDB Compounds: (A:) barnase

SCOPe Domain Sequences for d1bnea_:

Sequence; same for both SEQRES and ATOM records:

>d1bnea_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnlcdvapgksiggdifsnregk
lpgksgrtwreadinytcgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d1bnea_:

• d1bnea_ first appeared (with stable ids) in SCOP 1.55
  
• d1bnea_ appears in SCOPe 2.05
  
• d1bnea_ appears in SCOPe 2.07
  
• d1bnea_ appears in the current release, SCOPe 2.08