![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (158 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:1435057] [361667] (3 PDB entries) |
![]() | Domain d6hlya1: 6hly A:30-342 [361706] Other proteins in same PDB: d6hlya2, d6hlya3 automated match to d5l9sa_ complexed with edo, g9z |
PDB Entry: 6hly (more details), 1.4 Å
SCOPe Domain Sequences for d6hlya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hlya1 c.94.1.0 (A:30-342) automated matches {Agrobacterium tumefaciens [TaxId: 1435057]} adlvissyggsfqdaqtkayfdpyakasgvkvtgttgtgyakvkamvesgnvtwdvisae spafasevkdgllepidysvvkadnvpenfrtkygvgymvfgtnlawnkdkfpngvtpaq ffdpnvkgrrvlpsdatyslefalmgdgvkpadlypldvkralkvidrvkdqvigykgas diqalmqqgeadivyagtgriknaikaganwsyswegaladteywavpkgaphaaeamkf infavqaepqaeltrviaygptnvdalrlldpavakdlpsypanaklgavlnskwwndny davkaewttyimq
Timeline for d6hlya1: