Lineage for d6hlya1 (6hly A:30-342)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915208Species Agrobacterium tumefaciens [TaxId:1435057] [361667] (3 PDB entries)
  8. 2915209Domain d6hlya1: 6hly A:30-342 [361706]
    Other proteins in same PDB: d6hlya2, d6hlya3
    automated match to d5l9sa_
    complexed with edo, g9z

Details for d6hlya1

PDB Entry: 6hly (more details), 1.4 Å

PDB Description: structure in p212121 form of the pbp agtb in complex with agropinic acid from a.tumefacien r10
PDB Compounds: (A:) Agropine permease

SCOPe Domain Sequences for d6hlya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hlya1 c.94.1.0 (A:30-342) automated matches {Agrobacterium tumefaciens [TaxId: 1435057]}
adlvissyggsfqdaqtkayfdpyakasgvkvtgttgtgyakvkamvesgnvtwdvisae
spafasevkdgllepidysvvkadnvpenfrtkygvgymvfgtnlawnkdkfpngvtpaq
ffdpnvkgrrvlpsdatyslefalmgdgvkpadlypldvkralkvidrvkdqvigykgas
diqalmqqgeadivyagtgriknaikaganwsyswegaladteywavpkgaphaaeamkf
infavqaepqaeltrviaygptnvdalrlldpavakdlpsypanaklgavlnskwwndny
davkaewttyimq

SCOPe Domain Coordinates for d6hlya1:

Click to download the PDB-style file with coordinates for d6hlya1.
(The format of our PDB-style files is described here.)

Timeline for d6hlya1: