Lineage for d6c3ua_ (6c3u A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2550017Species Klebsiella pneumoniae [TaxId:573] [338697] (3 PDB entries)
  8. 2550022Domain d6c3ua_: 6c3u A: [361612]
    automated match to d5v91a_
    complexed with gol, mn, ny2

Details for d6c3ua_

PDB Entry: 6c3u (more details), 1.85 Å

PDB Description: crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any2) bound
PDB Compounds: (A:) FosA family fosfomycin resistance glutathione transferase

SCOPe Domain Sequences for d6c3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c3ua_ d.32.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
qrlaacreqpykgmvffe

SCOPe Domain Coordinates for d6c3ua_:

Click to download the PDB-style file with coordinates for d6c3ua_.
(The format of our PDB-style files is described here.)

Timeline for d6c3ua_: