SCOPe 2.08: Domain d5z18f1: 5z18 F:2-185

Lineage for d5z18f1 (5z18 F:2-185)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Ruminococcus gnavus [TaxId:33038] [361245] (8 PDB entries)

8. Domain d5z18f1: 5z18 F:2-185 [361330]
   Other proteins in same PDB: d5z18a2, d5z18a3, d5z18b2, d5z18b3, d5z18c2, d5z18c3, d5z18d2, d5z18d3, d5z18e2, d5z18e3, d5z18f2, d5z18f3
   automated match to d5c70a1

Details for d5z18f1

PDB Entry: 5z18, 2.5 Å

PDB Description: the crystal structure of ruminococcus gnavus beta-glucuronidase

PDB Compounds: (F:) beta-glucuronidase

SCOPe Domain Sequences for d5z18f1:

Sequence; same for both SEQRES and ATOM records:

>d5z18f1 b.18.1.0 (F:2-185) automated matches {Ruminococcus gnavus [TaxId: 33038]}
leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd
hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad
istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi
alpe

Timeline for d5z18f1:

• d5z18f1 first appeared in SCOPe 2.07