Lineage for d5yxnd_ (5yxn D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (950 PDB entries)
  8. 3061220Domain d5yxnd_: 5yxn D: [361282]
    Other proteins in same PDB: d5yxna1, d5yxnb1, d5yxnb2, d5yxnc1, d5yxnc2
    automated match to d2xfxb_

Details for d5yxnd_

PDB Entry: 5yxn (more details), 2.03 Å

PDB Description: a t cell receptor in complex with hla-a0201 restricted hepatitis c virus ns3 peptide (klvalginav)
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d5yxnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxnd_ b.1.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giqrtpkiqvysrhpaengksnflncyvsgfhpseievdllkngeriekvehsdlsfsed
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm

SCOPe Domain Coordinates for d5yxnd_:

Click to download the PDB-style file with coordinates for d5yxnd_.
(The format of our PDB-style files is described here.)

Timeline for d5yxnd_: