SCOPe 2.08: Domain d5yxna2: 5yxn A:114-193

Lineage for d5yxna2 (5yxn A:114-193)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5yxna2: 5yxn A:114-193 [361269]
   Other proteins in same PDB: d5yxna1, d5yxnb1, d5yxnb2, d5yxnc1, d5yxnc2
   automated match to d2ak4d2

Details for d5yxna2

PDB Entry: 5yxn, 2.03 Å

PDB Description: a t cell receptor in complex with hla-a0201 restricted hepatitis c virus ns3 peptide (klvalginav)

PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d5yxna2:

Sequence; same for both SEQRES and ATOM records:

>d5yxna2 b.1.1.2 (A:114-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnns

Timeline for d5yxna2:

• d5yxna2 first appeared in SCOPe 2.07