SCOPe 2.07: Domain d5yxnc1: 5yxn C:2-182

Lineage for d5yxnc1 (5yxn C:2-182)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
Uniprot P01892 25-298
Domain d5yxnc1: 5yxn C:2-182 [361253]
Other proteins in same PDB: d5yxna1, d5yxna2, d5yxnb1, d5yxnb2, d5yxnc2, d5yxnd_
automated match to d1i4fa2

Details for d5yxnc1

PDB Entry: 5yxn (more details), 2.03 Å

PDB Description: a t cell receptor in complex with hla-a0201 restricted hepatitis c virus ns3 peptide (klvalginav)

PDB Compounds: (C:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5yxnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxnc1 d.19.1.1 (C:2-182) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d5yxnc1:

Click to download the PDB-style file with coordinates for d5yxnc1.
(The format of our PDB-style files is described here.)

Timeline for d5yxnc1: