SCOPe 2.08: Domain d5yxnc1: 5yxn C:2-182

Lineage for d5yxnc1 (5yxn C:2-182)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
   Uniprot P01892 25-298

8. Domain d5yxnc1: 5yxn C:2-182 [361253]
   Other proteins in same PDB: d5yxna1, d5yxna2, d5yxnb1, d5yxnb2, d5yxnc2, d5yxnd_
   automated match to d1i4fa2

Details for d5yxnc1

PDB Entry: 5yxn, 2.03 Å

PDB Description: a t cell receptor in complex with hla-a0201 restricted hepatitis c virus ns3 peptide (klvalginav)

PDB Compounds: (C:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5yxnc1:

Sequence; same for both SEQRES and ATOM records:

>d5yxnc1 d.19.1.1 (C:2-182) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d5yxnc1:

• d5yxnc1 first appeared in SCOPe 2.07