Lineage for d5yxue1 (5yxu E:2-182)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937657Species Human (Homo sapiens) [TaxId:9606] [361260] (1 PDB entry)
  8. 2937659Domain d5yxue1: 5yxu E:2-182 [361261]
    Other proteins in same PDB: d5yxua1, d5yxua2, d5yxub1, d5yxub2, d5yxuc2, d5yxud_, d5yxue2, d5yxue3, d5yxuf1, d5yxuf2, d5yxug1, d5yxug2, d5yxuh_
    automated match to d1kjva2

Details for d5yxue1

PDB Entry: 5yxu (more details), 2.7 Å

PDB Description: an affinity enhanced t cell receptor in complex with hla-a0201 restricted hcv ns3 peptide klvalginav
PDB Compounds: (E:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5yxue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxue1 d.19.1.1 (E:2-182) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens) [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d5yxue1:

Click to download the PDB-style file with coordinates for d5yxue1.
(The format of our PDB-style files is described here.)

Timeline for d5yxue1: