Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens) [TaxId:9606] [361260] (1 PDB entry) |
Domain d5yxue1: 5yxu E:2-182 [361261] Other proteins in same PDB: d5yxua1, d5yxua2, d5yxub1, d5yxub2, d5yxuc2, d5yxud_, d5yxue2, d5yxue3, d5yxuf1, d5yxuf2, d5yxug1, d5yxug2, d5yxuh_ automated match to d1kjva2 |
PDB Entry: 5yxu (more details), 2.7 Å
SCOPe Domain Sequences for d5yxue1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yxue1 d.19.1.1 (E:2-182) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens) [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d5yxue1: