Lineage for d5yxub1 (5yxu B:1-113)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d5yxub1: 5yxu B:1-113 [361320]
    Other proteins in same PDB: d5yxua2, d5yxub2, d5yxuc1, d5yxud_, d5yxue1, d5yxue3, d5yxuf2, d5yxug2, d5yxuh_
    automated match to d4grmd1

Details for d5yxub1

PDB Entry: 5yxu (more details), 2.7 Å

PDB Description: an affinity enhanced t cell receptor in complex with hla-a0201 restricted hcv ns3 peptide klvalginav
PDB Compounds: (B:) T cell receptor beta chain

SCOPe Domain Sequences for d5yxub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxub1 b.1.1.0 (B:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgd
lssestvsrirtehfpltlesarpshtsqylcasrrgsaelyfgpgtrltvte

SCOPe Domain Coordinates for d5yxub1 are not available.

Timeline for d5yxub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yxub2
View in 3D
Domains from other chains:
(mouse over for more information)
d5yxua1, d5yxua2, d5yxuc1, d5yxuc2, d5yxud_, d5yxue1, d5yxue2, d5yxue3, d5yxuf1, d5yxuf2, d5yxug1, d5yxug2, d5yxuh_