SCOPe 2.08: Domain d5yxub1: 5yxu B:1-113

Lineage for d5yxub1 (5yxu B:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5yxub1: 5yxu B:1-113 [361320]
   Other proteins in same PDB: d5yxua2, d5yxub2, d5yxuc1, d5yxud_, d5yxue1, d5yxue3, d5yxuf2, d5yxug2, d5yxuh_
   automated match to d4grmd1

Details for d5yxub1

PDB Entry: 5yxu, 2.7 Å

PDB Description: an affinity enhanced t cell receptor in complex with hla-a0201 restricted hcv ns3 peptide klvalginav

PDB Compounds: (B:) T cell receptor beta chain

SCOPe Domain Sequences for d5yxub1:

Sequence; same for both SEQRES and ATOM records:

>d5yxub1 b.1.1.0 (B:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgd
lssestvsrirtehfpltlesarpshtsqylcasrrgsaelyfgpgtrltvte

Timeline for d5yxub1:

• d5yxub1 first appeared in SCOPe 2.07