SCOPe 2.08: Domain d5y64b_: 5y64 B:

Lineage for d5y64b_ (5y64 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186938] (20 PDB entries)

8. Domain d5y64b_: 5y64 B: [360898]
   automated match to d2hhja_
   complexed with 8lf, cl, mes

Details for d5y64b_

PDB Entry: 5y64, 2.15 Å

PDB Description: phosphoglycerate mutase 1 h11 phosphorylated form complexed with kh1

PDB Compounds: (B:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d5y64b_:

Sequence; same for both SEQRES and ATOM records:

>d5y64b_ c.60.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd

Timeline for d5y64b_:

• d5y64b_ first appeared in SCOPe 2.07