Lineage for d5y64c_ (5y64 C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. Protein automated matches [190196] (7 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186938] (20 PDB entries)
  8. Domain d5y64c_: 5y64 C: [360892]
    automated match to d2hhja_
    complexed with 8lf, cl, mes

Details for d5y64c_

PDB Entry: 5y64 (more details), 2.15 Å

PDB Description: phosphoglycerate mutase 1 h11 phosphorylated form complexed with kh1
PDB Compounds: (C:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d5y64c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y64c_ c.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd

SCOPe Domain Coordinates for d5y64c_ are not available.

Timeline for d5y64c_:

Domains from other chains:
(mouse over for more information)
d5y64b_