Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudodyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.1: Thiolase-related [53902] (6 proteins) |
Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species) |
Species Escherichia coli [TaxId:562] [53913] (7 PDB entries) |
Domain d1hnda2: 1hnd A:175-317 [35972] complexed with coa |
PDB Entry: 1hnd (more details), 1.6 Å
SCOP Domain Sequences for d1hnda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnda2 c.95.1.1 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli} isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik pgqlvlleafgggftwgsalvrf
Timeline for d1hnda2: