SCOP 1.63: Domain d1hnda1: 1hnd A:1-174

Lineage for d1hnda1 (1hnd A:1-174)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudodyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (6 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species)

7. Species Escherichia coli [TaxId:562] [53913] (7 PDB entries)

8. Domain d1hnda1: 1hnd A:1-174 [35971]

Details for d1hnda1

PDB Entry: 1hnd, 1.6 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii-coa complex

SCOP Domain Sequences for d1hnda1:

Sequence; same for both SEQRES and ATOM records:

>d1hnda1 c.95.1.1 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli}
mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgi

Timeline for d1hnda1:

• d1hnda1 first appeared (with stable ids) in SCOP 1.55
  
• d1hnda1 appears in SCOP 1.61
  
• d1hnda1 appears in SCOP 1.65
  
• d1hnda1 appears in the current release, SCOPe 2.08