Lineage for d6bfye2 (6bfy E:140-430)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836769Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2836880Protein automated matches [226973] (7 species)
    not a true protein
  7. 2836886Species Escherichia coli [TaxId:562] [359500] (3 PDB entries)
  8. 2836891Domain d6bfye2: 6bfy E:140-430 [359717]
    Other proteins in same PDB: d6bfya1, d6bfya3, d6bfyb1, d6bfyb3, d6bfyc1, d6bfyc3, d6bfyd1, d6bfyd3, d6bfye1, d6bfye3, d6bfyf1, d6bfyf3
    automated match to d2fymc1
    complexed with 2pg, gol, mg, so4

Details for d6bfye2

PDB Entry: 6bfy (more details), 1.81 Å

PDB Description: crystal structure of enolase from escherichia coli with bound 2- phosphoglycerate substrate
PDB Compounds: (E:) enolase

SCOPe Domain Sequences for d6bfye2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bfye2 c.1.11.1 (E:140-430) automated matches {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq

SCOPe Domain Coordinates for d6bfye2:

Click to download the PDB-style file with coordinates for d6bfye2.
(The format of our PDB-style files is described here.)

Timeline for d6bfye2: