Lineage for d6bfyb1 (6bfy B:0-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948215Species Escherichia coli [TaxId:562] [359490] (4 PDB entries)
  8. 2948217Domain d6bfyb1: 6bfy B:0-139 [359496]
    Other proteins in same PDB: d6bfya2, d6bfya3, d6bfyb2, d6bfyb3, d6bfyc2, d6bfyc3, d6bfyd2, d6bfyd3, d6bfye2, d6bfye3, d6bfyf2, d6bfyf3
    automated match to d2fyma2
    complexed with 2pg, gol, mg, so4

Details for d6bfyb1

PDB Entry: 6bfy (more details), 1.81 Å

PDB Description: crystal structure of enolase from escherichia coli with bound 2- phosphoglycerate substrate
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d6bfyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bfyb1 d.54.1.0 (B:0-139) automated matches {Escherichia coli [TaxId: 562]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt

SCOPe Domain Coordinates for d6bfyb1:

Click to download the PDB-style file with coordinates for d6bfyb1.
(The format of our PDB-style files is described here.)

Timeline for d6bfyb1: