| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Escherichia coli [TaxId:562] [359490] (4 PDB entries) |
| Domain d6bfye1: 6bfy E:0-139 [359716] Other proteins in same PDB: d6bfya2, d6bfya3, d6bfyb2, d6bfyb3, d6bfyc2, d6bfyc3, d6bfyd2, d6bfyd3, d6bfye2, d6bfye3, d6bfyf2, d6bfyf3 automated match to d2fyma2 complexed with 2pg, gol, mg, so4 |
PDB Entry: 6bfy (more details), 1.81 Å
SCOPe Domain Sequences for d6bfye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bfye1 d.54.1.0 (E:0-139) automated matches {Escherichia coli [TaxId: 562]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt
Timeline for d6bfye1: