SCOPe 2.07: Domain d6mjka1: 6mjk A:1-142

Lineage for d6mjka1 (6mjk A:1-142)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (19 species)
   not a true protein

7. Species Naegleria fowleri [TaxId:5763] [334024] (2 PDB entries)

8. Domain d6mjka1: 6mjk A:1-142 [359626]
   Other proteins in same PDB: d6mjka2
   automated match to d4oopb_
   complexed with dur, mg, ppv

Details for d6mjka1

PDB Entry: 6mjk, 1.45 Å

PDB Description: crystal structure of dutp pyrophosphatase protein, from naegleria fowleri in complex with deoxyuridine

PDB Compounds: (A:) dUTP pyrophosphatase

SCOPe Domain Sequences for d6mjka1:

Sequence; same for both SEQRES and ATOM records:

>d6mjka1 b.85.4.0 (A:1-142) automated matches {Naegleria fowleri [TaxId: 5763]}
mstpqlmrvkklsefailpvrssqfaagfdlasaydyvvpargkclvktdlavavphgyy
grvaprsglavknfidvgagvvdsdyrgnlgvllfnhgdedfkiargdriaqfvieqial
pdivevddldetergaggfgst

Timeline for d6mjka1:

• d6mjka1 is new in SCOPe 2.07-stable
  
• d6mjka1 appears in the current release, SCOPe 2.08