Lineage for d4oopb_ (4oop B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427616Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2427617Protein automated matches [191182] (19 species)
    not a true protein
  7. 2427848Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255543] (3 PDB entries)
  8. 2427850Domain d4oopb_: 4oop B: [271181]
    automated match to d3zeza_
    complexed with dup, mg

Details for d4oopb_

PDB Entry: 4oop (more details), 1.5 Å

PDB Description: arabidopsis thaliana dutpase with with magnesium and alpha,beta-imido- dutp
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d4oopb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oopb_ b.85.4.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pspffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyar
iaprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpd
vvevddldetvrgdggfgstgv

SCOPe Domain Coordinates for d4oopb_:

Click to download the PDB-style file with coordinates for d4oopb_.
(The format of our PDB-style files is described here.)

Timeline for d4oopb_: