SCOPe 2.08: Domain d5ynca1: 5ync A:32-162

Lineage for d5ynca1 (5ync A:32-162)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.0: automated matches [254199] (1 protein)
   not a true family

6. Protein automated matches [254436] (5 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [359371] (9 PDB entries)

8. Domain d5ynca1: 5ync A:32-162 [359389]
   Other proteins in same PDB: d5ynca2, d5ynca3, d5ynca4, d5ynca5
   automated match to d2fhfa3
   complexed with act, ca, gol

Details for d5ynca1

PDB Entry: 5ync, 2.32 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 1 mm beta-cyclodextrin

PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynca1:

Sequence; same for both SEQRES and ATOM records:

>d5ynca1 b.3.1.0 (A:32-162) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsap
vadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrtv
sviagnsavyd

Timeline for d5ynca1:

• d5ynca1 first appeared in SCOPe 2.07