Lineage for d5ynca3 (5ync A:288-402)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766341Species Klebsiella pneumoniae [TaxId:573] [359373] (10 PDB entries)
  8. 2766361Domain d5ynca3: 5ync A:288-402 [359391]
    Other proteins in same PDB: d5ynca1, d5ynca4, d5ynca5
    automated match to d2fhfa1
    complexed with act, ca, gol

Details for d5ynca3

PDB Entry: 5ync (more details), 2.32 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 1 mm beta-cyclodextrin
PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynca3 b.1.18.0 (A:288-402) automated matches {Klebsiella pneumoniae [TaxId: 573]}
yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq
ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk

SCOPe Domain Coordinates for d5ynca3:

Click to download the PDB-style file with coordinates for d5ynca3.
(The format of our PDB-style files is described here.)

Timeline for d5ynca3: